PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn380631
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 277aa    MW: 31174 Da    PI: 6.4021
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn380631genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.86.9e-15120164347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+Wk I+r +  +Rt  q+ s+ qky
       Achn380631 120 PWTEEEHKLFLMGLKKYGKGDWKNISRNFVITRTSTQVASHAQKY 164
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.732863IPR017884SANT domain
SMARTSM007178.3E-8961IPR001005SANT/Myb domain
SuperFamilySSF466893.8E-111266IPR009057Homeodomain-like
CDDcd001674.99E-81358No hitNo description
Gene3DG3DSA:1.10.10.606.4E-13110169IPR009057Homeodomain-like
PROSITE profilePS5129420.283113169IPR017930Myb domain
SuperFamilySSF466895.01E-17114168IPR009057Homeodomain-like
TIGRFAMsTIGR015578.0E-18116168IPR006447Myb domain, plants
SMARTSM007176.0E-13117167IPR001005SANT/Myb domain
CDDcd001674.00E-11120165No hitNo description
PfamPF002495.6E-13120164IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MEILSPASFL SGWTLEENKM FENALAIYDE ATPDRWKKVA AMIPGKTVWD VMKQYTELEE  60
DVSSIEAGWI PIPRYCAPPF TFDWGDTDGF DGGFKPSDIP GRKRSSSGRN SEQERKKGVP  120
WTEEEHKLFL MGLKKYGKGD WKNISRNFVI TRTSTQVASH AQKYFIRQLS GGKDKRRASI  180
HDITTVNLHD HQTPSPDLKR PPSPDQPNSA PIPINHFQWN QQNSGIGMGF NQTQGNAFAS  240
PCFGINSYIC NPVIDGEIFE NSLGDLELMP HLFSVY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A6e-1513751173RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002299827.21e-121hypothetical protein POPTR_0001s25590g
SwissprotQ8S9H71e-111DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLB9GIV01e-121B9GIV0_POPTR; Uncharacterized protein
STRINGPOPTR_0001s25590.11e-120(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.14e-91Homeodomain-like transcriptional regulator